🎧 New Hoosier Health Matters episode is out!
Episode 36 tackles Indiana’s Medicaid stalemate, funding gaps, and why this legislative “Groundhog Day” puts patients and providers at risk. Listen now and stay informed.
#GTC #HealthPodcast #IndianaPolitics #HoosierSky
Episode 36 tackles Indiana’s Medicaid stalemate, funding gaps, and why this legislative “Groundhog Day” puts patients and providers at risk. Listen now and stay informed.
#GTC #HealthPodcast #IndianaPolitics #HoosierSky
February 7, 2026 at 3:46 PM
🎧 New Hoosier Health Matters episode is out!
Episode 36 tackles Indiana’s Medicaid stalemate, funding gaps, and why this legislative “Groundhog Day” puts patients and providers at risk. Listen now and stay informed.
#GTC #HealthPodcast #IndianaPolitics #HoosierSky
Episode 36 tackles Indiana’s Medicaid stalemate, funding gaps, and why this legislative “Groundhog Day” puts patients and providers at risk. Listen now and stay informed.
#GTC #HealthPodcast #IndianaPolitics #HoosierSky
December 13, 2025 at 4:13 AM
Episode 10 Food Safety provides insight into proper #foodtemperatures
#health #diet #nutrition #healthpodcast
#health #diet #nutrition #healthpodcast
November 17, 2025 at 4:40 PM
Episode 10 Food Safety provides insight into proper #foodtemperatures
#health #diet #nutrition #healthpodcast
#health #diet #nutrition #healthpodcast
More #foodsafety tips from this week’s episode of Staying Alive With Margaret and Susy
#healthpodcast #nutrition
#healthpodcast #nutrition
November 22, 2025 at 10:05 PM
More #foodsafety tips from this week’s episode of Staying Alive With Margaret and Susy
#healthpodcast #nutrition
#healthpodcast #nutrition
Would you recognize the symptoms of gastro-esophageal reflux disease? They aren’t always easy to identify.
#womenshealth #healthpodcast
#GERD #heartburn #medsky
#womenshealth #healthpodcast
#GERD #heartburn #medsky
April 21, 2025 at 3:46 PM
Would you recognize the symptoms of gastro-esophageal reflux disease? They aren’t always easy to identify.
#womenshealth #healthpodcast
#GERD #heartburn #medsky
#womenshealth #healthpodcast
#GERD #heartburn #medsky
Join me and Dr. Louis Saeger on our latest health podcast episode, “Understanding Multiple Pain Generators.”
FULL EPISODE
https://buff.ly/3Wmy9xa
#healthpodcast #wellnesspodcast #drsinicropi #wellness #healthtips #healtheducation
FULL EPISODE
https://buff.ly/3Wmy9xa
#healthpodcast #wellnesspodcast #drsinicropi #wellness #healthtips #healtheducation
January 20, 2025 at 9:00 PM
Join me and Dr. Louis Saeger on our latest health podcast episode, “Understanding Multiple Pain Generators.”
FULL EPISODE
https://buff.ly/3Wmy9xa
#healthpodcast #wellnesspodcast #drsinicropi #wellness #healthtips #healtheducation
FULL EPISODE
https://buff.ly/3Wmy9xa
#healthpodcast #wellnesspodcast #drsinicropi #wellness #healthtips #healtheducation
Learn how GLP aid weight loss by releasing insulin, lowering blood glucose, and suppressing appetite!
YouTube: youtu.be/FgggM2lZ0aA
Spotify: surl.li/dsryco
Apple Podcast: bit.ly/4hSgHcS
#drsinicropi #drmeyer #wellness #healthpodcast #diabetes #wellnessatthespeedoflight #drsinicropi #health
YouTube: youtu.be/FgggM2lZ0aA
Spotify: surl.li/dsryco
Apple Podcast: bit.ly/4hSgHcS
#drsinicropi #drmeyer #wellness #healthpodcast #diabetes #wellnessatthespeedoflight #drsinicropi #health
November 20, 2024 at 1:05 AM
Learn how GLP aid weight loss by releasing insulin, lowering blood glucose, and suppressing appetite!
YouTube: youtu.be/FgggM2lZ0aA
Spotify: surl.li/dsryco
Apple Podcast: bit.ly/4hSgHcS
#drsinicropi #drmeyer #wellness #healthpodcast #diabetes #wellnessatthespeedoflight #drsinicropi #health
YouTube: youtu.be/FgggM2lZ0aA
Spotify: surl.li/dsryco
Apple Podcast: bit.ly/4hSgHcS
#drsinicropi #drmeyer #wellness #healthpodcast #diabetes #wellnessatthespeedoflight #drsinicropi #health
October 10, 2025 at 4:29 PM
🎙️ New episode of Hoosier Health Matters is live!
This week: Indiana kids losing Medicaid coverage, mifepristone misinformation, and a conversation with Sen. Bohacek about medical marijuana in Indiana.
Listen on our website or Apple Podcasts.
#HoosierSky #GTC #HealthPodcast
This week: Indiana kids losing Medicaid coverage, mifepristone misinformation, and a conversation with Sen. Bohacek about medical marijuana in Indiana.
Listen on our website or Apple Podcasts.
#HoosierSky #GTC #HealthPodcast
June 23, 2026 at 12:53 PM
🎙️ New episode of Hoosier Health Matters is live!
This week: Indiana kids losing Medicaid coverage, mifepristone misinformation, and a conversation with Sen. Bohacek about medical marijuana in Indiana.
Listen on our website or Apple Podcasts.
#HoosierSky #GTC #HealthPodcast
This week: Indiana kids losing Medicaid coverage, mifepristone misinformation, and a conversation with Sen. Bohacek about medical marijuana in Indiana.
Listen on our website or Apple Podcasts.
#HoosierSky #GTC #HealthPodcast
Susy and Margaret spend episode 2 discussing #hydration, offering indispensable tips for staying #hydrated.
#stayingalivewithmargaretandsusy #podcast #Healthpodcast #wellness #healthybody
#stayingalivewithmargaretandsusy #podcast #Healthpodcast #wellness #healthybody
September 18, 2025 at 10:23 PM
Susy and Margaret spend episode 2 discussing #hydration, offering indispensable tips for staying #hydrated.
#stayingalivewithmargaretandsusy #podcast #Healthpodcast #wellness #healthybody
#stayingalivewithmargaretandsusy #podcast #Healthpodcast #wellness #healthybody
How to handle #stress and curb #cognitive decline and #dementia
#health #nutrition #healthpodcast #aginggracefully
#health #nutrition #healthpodcast #aginggracefully
December 18, 2025 at 6:27 PM
How to handle #stress and curb #cognitive decline and #dementia
#health #nutrition #healthpodcast #aginggracefully
#health #nutrition #healthpodcast #aginggracefully
Recommended #fiber amount for men/women changes as we age
#inflammation #diet #nutrition
#Healthpodcast
#inflammation #diet #nutrition
#Healthpodcast
December 5, 2025 at 9:09 PM
Recommended #fiber amount for men/women changes as we age
#inflammation #diet #nutrition
#Healthpodcast
#inflammation #diet #nutrition
#Healthpodcast
Meal planning for a balanced diet.
#mealplanning #balanceddiet #health #nutrition #stayingalivewithmargaretandsusy #healthpodcast
#mealplanning #balanceddiet #health #nutrition #stayingalivewithmargaretandsusy #healthpodcast
September 28, 2025 at 10:54 PM
Meal planning for a balanced diet.
#mealplanning #balanceddiet #health #nutrition #stayingalivewithmargaretandsusy #healthpodcast
#mealplanning #balanceddiet #health #nutrition #stayingalivewithmargaretandsusy #healthpodcast
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
July 27, 2025 at 2:07 AM
Follow @biohackingpathway for more
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
Indiana has billions in surplus, so why aren't kids getting summer meals?
We break that down, plus the latest lettuce recall and recent health law cases.
🎧 Listen on our website or Apple Podcasts. Link in bio.
#HoosierSky #GTC #HealthPodcast
We break that down, plus the latest lettuce recall and recent health law cases.
🎧 Listen on our website or Apple Podcasts. Link in bio.
#HoosierSky #GTC #HealthPodcast
July 31, 2026 at 5:42 PM
Indiana has billions in surplus, so why aren't kids getting summer meals?
We break that down, plus the latest lettuce recall and recent health law cases.
🎧 Listen on our website or Apple Podcasts. Link in bio.
#HoosierSky #GTC #HealthPodcast
We break that down, plus the latest lettuce recall and recent health law cases.
🎧 Listen on our website or Apple Podcasts. Link in bio.
#HoosierSky #GTC #HealthPodcast
Susy and Margaret clarify what ‘Good Carbs’ are.
#carbs #stayingalivewithmargaretandsusy #healthpodcast #diabetes #nutrition
#carbs #stayingalivewithmargaretandsusy #healthpodcast #diabetes #nutrition
October 1, 2025 at 1:02 AM
Susy and Margaret clarify what ‘Good Carbs’ are.
#carbs #stayingalivewithmargaretandsusy #healthpodcast #diabetes #nutrition
#carbs #stayingalivewithmargaretandsusy #healthpodcast #diabetes #nutrition
Discover natural lifestyle ideas to keep your #NervousSystem calm, and decrease #inflammation
#health #nutrition #diet #healthpodcast
#health #nutrition #diet #healthpodcast
December 3, 2025 at 6:18 PM
Discover natural lifestyle ideas to keep your #NervousSystem calm, and decrease #inflammation
#health #nutrition #diet #healthpodcast
#health #nutrition #diet #healthpodcast
🌬️ Feeling heavy in your chest or shoulders? Let’s release it together.
🌿 Watch the full podcast episode and sign up for a free online Qi Gong class here: podcast.joannefaulkner.ie
#reducepainnaturally #qigongonline #qigongclass #acupressureforpain #fitover45 #ChiFlow #askmeanything #healthpodcast
🌿 Watch the full podcast episode and sign up for a free online Qi Gong class here: podcast.joannefaulkner.ie
#reducepainnaturally #qigongonline #qigongclass #acupressureforpain #fitover45 #ChiFlow #askmeanything #healthpodcast
February 7, 2025 at 9:34 AM
🌬️ Feeling heavy in your chest or shoulders? Let’s release it together.
🌿 Watch the full podcast episode and sign up for a free online Qi Gong class here: podcast.joannefaulkner.ie
#reducepainnaturally #qigongonline #qigongclass #acupressureforpain #fitover45 #ChiFlow #askmeanything #healthpodcast
🌿 Watch the full podcast episode and sign up for a free online Qi Gong class here: podcast.joannefaulkner.ie
#reducepainnaturally #qigongonline #qigongclass #acupressureforpain #fitover45 #ChiFlow #askmeanything #healthpodcast
The important relationship between #carbohydrates and #protein for a #HealthyBody
#healthpodcast #stayingalivewithmargaretandsusy #diet #nutrition
#healthpodcast #stayingalivewithmargaretandsusy #diet #nutrition
October 4, 2025 at 9:04 PM
The important relationship between #carbohydrates and #protein for a #HealthyBody
#healthpodcast #stayingalivewithmargaretandsusy #diet #nutrition
#healthpodcast #stayingalivewithmargaretandsusy #diet #nutrition
🧠 The Invisible Scars: What COVID is Really Doing to Our Brains
www.buzzsprout.com/2405788/epis...
helioxpodcast.substack.com/publish/post...
#COVIDBrain #LongCOVID #BrainHealth #Neuroscience #COVIDResearch #HealthPodcast #MedicalResearch #BrainFog #COVIDEffects #PodcastLife
www.buzzsprout.com/2405788/epis...
helioxpodcast.substack.com/publish/post...
#COVIDBrain #LongCOVID #BrainHealth #Neuroscience #COVIDResearch #HealthPodcast #MedicalResearch #BrainFog #COVIDEffects #PodcastLife
June 19, 2025 at 4:32 PM
🧠 The Invisible Scars: What COVID is Really Doing to Our Brains
www.buzzsprout.com/2405788/epis...
helioxpodcast.substack.com/publish/post...
#COVIDBrain #LongCOVID #BrainHealth #Neuroscience #COVIDResearch #HealthPodcast #MedicalResearch #BrainFog #COVIDEffects #PodcastLife
www.buzzsprout.com/2405788/epis...
helioxpodcast.substack.com/publish/post...
#COVIDBrain #LongCOVID #BrainHealth #Neuroscience #COVIDResearch #HealthPodcast #MedicalResearch #BrainFog #COVIDEffects #PodcastLife
Our final episode from season 1 just dropped: Fruits and Vegetables. Found on all major podcast platforms.
#nutrition #health #diet #healthpodcast
#nutrition #health #diet #healthpodcast
December 29, 2025 at 5:08 PM
Our final episode from season 1 just dropped: Fruits and Vegetables. Found on all major podcast platforms.
#nutrition #health #diet #healthpodcast
#nutrition #health #diet #healthpodcast