#SleepHealth
LightNews LightNews
biohackingpathway.bsky.social
Follow @biohackingpathway for more

#sleepscience #sleepdisorders #circadianrhythm #genetics #podcast #sleephacks #healthpodcast #wellbeing #sleephealth #familialadvancedsleepphasesyndrome
November 10, 2026 at 8:05 AM
daily-fitness-tips.bsky.social
How Ten Minutes of Non-Sleep Deep Rest Clears Brain Fog
#mentalhealth #mindset #stressrelief #wellness #sleephealth #mentalclarity
November 10, 2026 at 8:30 AM
theedcdoc.bsky.social
🌙 Better sleep begins before bedtime.

Bright evening light can disrupt melatonin signaling.

💚 Dim the lights, put screens away, and keep a regular sleep schedule.

#TheEDCDoc #SleepHealth #Melatonin
November 13, 2026 at 6:21 PM
biohackingpathway.bsky.social
The Secret to Muscle Gains? Sleep More 😴💪 ⁣⁣
⁣⁣
⁣⁣
⁣Follow @biohackingpathway for more⁣
⁣
⁣
⁣⁣
#health #musclegrowth #sleepforgains #fitness #bodybuilding #sleephealth #resistancetraining #protein #fitnessmotivation #healthtips #musclebuilding #recovery #sleepdeprivation
November 12, 2026 at 4:05 AM
imbibelifestyles.bsky.social
Firm doesn’t always mean better. Support and alignment matter more than stiffness.
#ImbibeSleep #BetterSleep #SleepWellness #SleepHealth #SleepUpgrade
November 9, 2026 at 2:04 PM
alignorthowell.bsky.social
Wake-up time may matter more than hours slept.

In 60,977 adults, regular sleepers had 20-48% lower death risk than the least regular. Pick one wake time, weekends too.

Programs: https://alignwell.repeatmd.app/discover?utm_source=bsky&utm_medium=organic&utm_campaign=p3-sleep-2611
#SleepHealth
November 12, 2026 at 11:32 PM
gmj-georgia.bsky.social
As heatwaves intensify globally, sleep disruption becomes a major public health concern. New guidance identifies 8 evidence-based strategies—from strategic window c…

#Environmentalhealth #Heatstress #Heatwave #Publichealth #Sleephealth

#Environmentalhealth #Heatstress #Heatwave #Publichealth #S…
Sleep in Heat: 8 Evidence-Based Cooling Strategies
As heatwaves intensify globally, sleep disruption becomes a major public health concern. New guidance identifies 8 evidence-based strategies—from strategic window c… #Environmentalhealth #Heatstress #Heatwave #Publichealth #Sleephealth
news.gmj.ge
November 11, 2026 at 1:26 AM
radiomorelove.bsky.social
Your sleep quality is entering a new era for chronic pain — restorative, revealing, essential. 🌙 Pain, rest, and recovery are more connected than you think. Listen now at http://radiomore.love #SleepHealth #ChronicPain

Photo AI, mindbodygreen
November 11, 2026 at 8:06 AM
bsfavourite.bsky.social
GP: How Do Better Sleep and Morning Sunlight Help Prevent Blood Clots? #SleepHealth
How Do Better Sleep and Morning Sunlight Help Prevent Blood Clots?
Most people know that sleep is important for heart health. The post How Do Better Sleep and Morning Sunlight Help Prevent Blood Clots? appeared first on The Gateway Pundit.
dlvr.it
November 13, 2026 at 3:41 PM
quartzmedia.bsky.social
That Nightcap Is Wrecking Your Sleep, Doctor Warns

Alcohol may knock you out faster, but a sleep medicine physician says it sa

#SleepHealth

#AlcoholAndSleep

#REMSleep

https://qz.com/physician-alcohol-sleep-aid-disrupts-rem-sleep-110926?utm_source=bluesky&utm_medium=social&utm_campaign=qzd-image
Branded article card: That Nightcap Is Wrecking Your Sleep, Doctor Warns
November 9, 2026 at 7:56 PM
talker.news
The average American felt mentally “half present” 67 days over the past year.

#SleepHealth #Burnout #GenZ #Millennials #GenX #BabyBoomers #ColdAndFlu #FluSeason #MentalHealth
Americans feel mentally checked out nearly 2 months a year
The survey of 2,000 U.S. adults revealed that people experience this at least once per week, or an average of 5.6 days per month.
talker.news
November 13, 2026 at 3:15 PM
respishop.bsky.social
Why Is Quality Sleep Important for Your Health?
A good night's sleep is essential for maintaining overall health and well-being.

Explore respiratory care solutions at Respishop.

Visit: respishop.in

#SleepHealth #CPAPTherapy #SleepApnea #RespiratoryCare #Respishop
Respishop - ResMed CPAP & BIPAP Machines Dealer in Bhubaneswar, India
Respishop in Bhubaneswar offers ResMed CPAP, BiPAP, and sleep therapy devices. Explore top brands, best prices, and authorized dealer services in Bhubaneswar, India.
respishop.in
November 13, 2026 at 4:45 AM
samirmlm.bsky.social
Sugar cravings after a bad night? It’s not willpower 😴🍪 How sleep and appetite are linked, and how to break the cycle.
#SleepHealth #Cravings #HealthyHabits
Sleep and Appetite: Why You Crave Sugar When You’re Tired
After a bad night, the biscuit tin seems louder. Here’s how sleep and appetite are linked, and how to break the tired-and-hungry cycle.
elvaneva.co.uk
November 11, 2026 at 9:02 AM
primrlab.bsky.social
(3) EN: Early follow-up and a well-fitted mask can also support success. 🛌🏻🫁💤

#ObstructiveSleepApnea #CPAP #SleepHealth
November 7, 2026 at 12:06 PM
southfloridamedia.bsky.social
😴 Can a Nap Help You Catch Up on Lost Sleep?

https://sfl.media/can-a-nap-help-catch-up-on-lost-sleep/

💼 Post Hashtags:
#SleepHealth #PowerNap #HealthySleep #SleepAwareness #Wellness #HealthTips #BetterSleep #HealthyLifestyle #SFLMedia
Can a Nap Help You Catch Up After a Bad Night’s Sleep? What Sleep Experts Say
Can a Nap Help You Catch Up on Lost Sleep? Getting a bad night’s sleep can affect everything from concentration and mood to energy levels and productivity the…
sfl.media
November 11, 2026 at 6:22 PM
healthday.bsky.social
A new study finds pulse oximeters — small devices that measure blood oxygen levels – may underestimated breathing events in Black patients.
youtu.be/_MBhMsBJBEI

#SleepApnea #ObstructiveSleepApnea #SleepHealth #SleepStudy #SleepDisorders
Common Sleep Apnea Test May Miss the Condition in Black Patients
YouTube video by HealthDay
youtu.be
November 8, 2026 at 4:48 PM
divneta.bsky.social
💡 Светлината е и сигнал за времето. Как дневната светлина и ярките вечери се свързват с биологичния часовник — и какво можем да променим у дома? 👉 divneta.com/svetlina-sut...

#CircadianRhythm #SleepHealth
Светлина сутрин, спокойствие вечер: Как осветлението разговаря с биологичния ни часовник - divneta.com
Сутрин включваме лампата, поглеждаме телефона и започваме деня. Вечер отново сме пред екран — често под същото осветление.
divneta.com
November 9, 2026 at 9:28 PM
cavemanprinciples.bsky.social
Sleep is not wasted time. Sleep is when caveman brain sorts the mammoth hunt, stores the lesson, resets the system.

Steal sleep, steal performance.

#SleepHealth #PeakPerformance
November 7, 2026 at 8:34 AM
alisonbladh.bsky.social
Morning or evening exercise for better sleep?
A 2026 review of 25 studies found no clear winner! But intense exercise near bedtime may disrupt sleep.
pubmed.ncbi.nlm.nih.gov/42632303/
#Menopause #SleepHealth #WomenOver40
November 7, 2026 at 7:45 AM
focusofwellness.bsky.social
Spending enough hours in bed, but still waking up tired? The pattern may be in your evening routine, not just your sleep schedule.

Interested? Get started today: https://focusofwellness.com/index.php/2026/10/29/sleep-optimization-with-smart-rings/

#SleepHealth #Wellness
November 8, 2026 at 12:01 AM
europeanlung.bsky.social
👶 Are you a parent or caregiver of child under 2 with a sleep-related breathing problem?

Help improve future care and support by completing a short anonymous survey: https://bit.ly/4AeKRPW

⏱️ Around 12 minutes

#SleepHealth #Research #PatientVoice
November 7, 2026 at 9:25 AM
healcity.bsky.social
Wondering how to fall asleep quickly? 🌙

Try giving your bedtime routine a little more attention!

▶️ Watch this video!
🔁 Share with someone you care!

#SleepTips #BetterSleep #SleepHealth

💙 Just a friendly reminder: This is educational content, not medical advice.
November 7, 2026 at 2:01 AM
focusofwellness.bsky.social
Spending enough hours in bed, but still waking up tired? The pattern may be in your evening routine, not just your sleep schedule.

Interested? Get started today: https://focusofwellness.com/index.php/2026/10/29/sleep-optimization-with-smart-rings/

#SleepHealth #Wellness
November 7, 2026 at 12:01 AM